PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0394s0050.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 484aa    MW: 53362.4 Da    PI: 4.2105
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0394s0050.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM80.24.4e-2536565128
                     NAM  65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             dkky +g+++nrat++gyWk+tgkd+++ + ++++vg+kktLv+++grap+g++++Wvmheyrl
  SapurV1A.0394s0050.3.p   3 DKKYGNGSKTNRATEKGYWKTTGKDRSIRQ-NSQVVGMKKTLVYHQGRAPRGQRSNWVMHEYRL 65 
                             799**************************9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.226187IPR003441NAC domain
SuperFamilySSF1019412.48E-29387IPR003441NAC domain
PfamPF023652.6E-111065IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MLDKKYGNGS KTNRATEKGY WKTTGKDRSI RQNSQVVGMK KTLVYHQGRA PRGQRSNWVM  60
HEYRLVDEEL EKAGIADAFV LCRIFQKSGT GPKNGEQYGA PFIEEEWDDD EVPLLPGEEE  120
MVLTEEAPVG DDAYLEMNEL GQNFDTGITS ENTALPQNFY YGEASNYVEQ PRDFSEDDLK  180
PMLRGAENRH GPSVPAEENL DLPGQYEMNA VKNEYATEHI NNVNAVDENY LFDESYLDAL  240
NNLPPSEGLF LEANDLSKPV EPETGGDSSG FDMLEEYLNF FDADDENMSF DPSDFLASDT  300
AVSNQQPPPQ ENVKGGSEEV LKAIQKPLET LGNVDPSSSK QKLEAMEFDS DFKYPFIKQA  360
SHMLGKIPAP PALASEFPSK DAALRLQSAS SSSVHVTAGM IRIESMSLGG NGTDWSFGKN  420
GNVNIILSLG LPQQGGPASM VPMTSVFSGK AEPVVSWGWL FLMLFWILIL SVSYKIGTCI  480
CAK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A9e-2339383174NAC domain-containing protein 19
3swm_B9e-2339383174NAC domain-containing protein 19
3swm_C9e-2339383174NAC domain-containing protein 19
3swm_D9e-2339383174NAC domain-containing protein 19
3swp_A9e-2339383174NAC domain-containing protein 19
3swp_B9e-2339383174NAC domain-containing protein 19
3swp_C9e-2339383174NAC domain-containing protein 19
3swp_D9e-2339383174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031618.10.0PREDICTED: NAC domain-containing protein 78-like isoform X1
TrEMBLU5G4S60.0U5G4S6_POPTR; Uncharacterized protein
STRINGPOPTR_0008s03170.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-115NAC domain containing protein 2